제품 > 항체 > 단일클론항체(mAb)

KRAS+HRAS+NRAS Rabbit mAb (A22438)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using KRAS+HRAS+NRAS Rabbit mAb (A22438) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - KRAS+HRAS+NRAS Rabbit mAb (A22438)

Immunofluorescence analysis of NIH/3T3 cells using KRAS+HRAS+NRAS Rabbit mAb (A22438) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using KRAS+HRAS+NRAS Rabbit mAb (A22438) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using KRAS+HRAS+NRAS Rabbit mAb (A22438) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - KRAS+HRAS+NRAS Rabbit mAb (A22438)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg KRAS+HRAS+NRAS antibody (A22438). Western blot was performed from the immunoprecipitate using KRAS+HRAS+NRAS antibody (A22438) at a dilution of 1:1000.

Overview

Product name	KRAS+HRAS+NRAS Rabbit mAb
Catalog No.	A22438
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2656

Background

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq, Jul 2008]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ras (P01111).
Sequence	MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQI
Gene ID
Swiss Prot
Synonyms	C-K-RAS; CFC2; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; KI-RAS; KRAS1; KRAS2; NS; NS3; RALD; RASK2; c-Ki-ras2; KRAS+HRAS+NRAS
Calculated MW	21kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T, MCF7, Mouse lung, Mouse brain, Rat lung, Rat brain
Cellular location	Cytosol, Extracellular exosome, Golgi apparatus, Plasma membrane
Customer validation	WB(Homo sapiens)