제품 > 항체 > 다중클론항체(pAb)

KTN1 Rabbit pAb (A12456)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using KTN1 antibody (A12456) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	KTN1 Rabbit pAb
Catalog No.	A12456
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an integral membrane protein that is a member of the kinectin protein family. The encoded protein is primarily localized to the endoplasmic reticulum membrane. This protein binds kinesin and may be involved in intracellular organelle motility. This protein also binds translation elongation factor-delta and may be involved in the assembly of the elongation factor-1 complex. Alternate splicing results in multiple transcript variants of this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1).
Sequence	MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV
Gene ID
Swiss Prot
Synonyms	CG1; KNT; MU-RMS-40.19
Calculated MW	156kDa
Observed MW	178kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	K-562, SKOV3, Raji, HeLa, HT-1080, Mouse heart, Rat testis
Cellular location	Endoplasmic reticulum membrane, Single-pass type II membrane protein
Customer validation	WB(Arabidopsis thaliana)