제품 > 항체 > 단일클론항체(mAb)

Kappa light chain Rabbit mAb (A18740)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Human plasma , using Kappa light chain Rabbit mAb (A18740) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Kappa light chain Rabbit mAb (A18740)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Kappa light chain Rabbit mAb (A18740) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	Kappa light chain Rabbit mAb
Catalog No.	A18740
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2527

Background

Immunoglobulins are polypeptides and comprise five major classes

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human Kappa light chain (P01601).
Sequence	MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP
Gene ID
Swiss Prot
Synonyms	HCAK 1; Kappa light chain
Calculated MW
Observed MW	25kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Human plasma
Cellular location	Cytoplasmic and Secreted