제품 > 항체 > 다중클론항체(pAb)

Kdm6b Rabbit pAb (A12767)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of Mouse brain, using Kdm6b Rabbit pAb antibody (A12767) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Kdm6b Rabbit pAb
Catalog No.	A12767
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables beta-catenin binding activity; histone H3-tri/di-methyl-lysine-27 demethylase activity; and sequence-specific DNA binding activity. Involved in several processes, including histone H3-K27 demethylation; mesodermal cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including cellular response to hydrogen peroxide; histone demethylation; and positive regulation of transcription by RNA polymerase II. Located in nucleus. Is expressed in several structures, including brain; gut; liver; metanephros; and olfactory epithelium. Orthologous to human KDM6B (lysine demethylase 6B).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Kdm6b (NP_001017426.1).
Sequence	LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA
Gene ID
Swiss Prot
Synonyms	Jmjd3; 1700064E03Rik
Calculated MW	176kDa
Observed MW	177kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain
Cellular location	Nucleus