Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Immunohistochemistry analysis of paraffin-embedded Human appendix using Ki67 Rabbit mAb (A21861) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.05M Tris/EDTA Buffer (pH 8.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using Ki67 Rabbit mAb (A21861) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.05M Tris/EDTA Buffer (pH 8.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Ki67 Rabbit mAb (A21861) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ki67 Rabbit mAb (A21861) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Ki67 Rabbit mAb (A21861) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ki67 Rabbit mAb (A21861) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Ki67 Rabbit mAb (A21861) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Ki67 Rabbit mAb (A21861) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of A-549 cells using Ki67 Rabbit mAb (A21861) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using Ki67 Rabbit mAb (A21861) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded Mouse spleen using Ki67 Rabbit mAb (A21861) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Ki67 Rabbit mAb |
|---|---|
| Catalog No. | A21861 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC5050-01 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Ki67 (NP_002408.3). |
|---|---|
| Sequence | LAGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | KIA; MIB-; MIB-1; PPP1R105; Ki67 |
| Calculated MW | 359kDa |
| Observed MW | Refer to figures |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Immunohistochemistry Immunofluorescence |
| Positive samples | |
| Cellular location | Chromosome, Nucleus, nucleolus. |
| Customer validation | IHC(Homo sapiens, Mus musculus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21861? Please let us know so that we can cite the reference in this datasheet.
