Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Ki67 Rabbit mAb (A23722) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ki67 Rabbit mAb (A23722) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Ki67 Rabbit mAb (A23722) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Ki67 Rabbit mAb (A23722) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Ki67 Rabbit mAb (A23722) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Ki67 Rabbit mAb (A23722) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Ki67 Rabbit mAb (A23722) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Confocal imaging of HeLa cells using Ki67 Rabbit mAb (A23722, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of Neuro-2a cells using Ki67 Rabbit mAb (A23722, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of paraffin-embedded Rat spleen tissue using Ki67 Rabbit mAb (A23722, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Flow cytometry: 1X10^6 knockout (KO) HeLa cells (negative control, left) and HeLa cells (right) were intracellularly-stained with Ki67 Rabbit mAb (A23722, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
| Product name | Ki67 Rabbit mAb |
|---|---|
| Catalog No. | A23722 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC57561 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2271-2370 of human Ki67 (NP_002408.3). |
|---|---|
| Sequence | PAGGDEKDMKAFMGTPVQKLDLPGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKIACKSPQPDPVDTPASTKQRPKRNLRKADVE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | KIA; MIB-; MIB-1; PPP1R105; Ki67 |
| Calculated MW | 359kDa |
| Observed MW | Refer to figures |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Immunohistochemistry Immunofluorescence Flow Cytometry |
| Positive samples | |
| Cellular location | Chromosome, Nucleus, nucleolus. |
| Customer validation | IF(Rattus norvegicus) IHC(Mus musculus, Homo sapiens) Other(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23722? Please let us know so that we can cite the reference in this datasheet.
