Reviews (2)Publications (8) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Ku70 Rabbit pAb (A7330) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Rat brain using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human uterus using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of A549 cells using Ku70 Rabbit pAb (A7330). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U2OS cells using Ku70 Rabbit pAb (A7330) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 100 μg extracts of SW480 cells using 3 μg Ku70 antibody (A7330). Western blot was performed from the immunoprecipitate using Ku70 antibody (A7330) at a dilution of 1:1000.
| Product name | Ku70 Rabbit pAb |
|---|---|
| Catalog No. | A7330 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 501-600 of human Ku70 (NP_001460.1). |
|---|---|
| Sequence | EQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ML8; KU70; TLAA; CTC75; CTCBF; G22P1; Ku70 |
| Calculated MW | 70kDa |
| Observed MW | 70kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | COS-7, SW480, Mouse brain |
| Cellular location | Chromosome, Nucleus |
| Customer validation | (Human renal epithelial cell line) WB(Homo sapiens) IHC(Mus musculus) IF(Homo sapiens) IP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A7330? Please let us know so that we can cite the reference in this datasheet.
