제품 > 항체 > 단일클론항체(mAb)

Ku70 Rabbit mAb (A11223)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from A-549 cells using Ku70 Rabbit mAb (A11223) at 1:6000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Ku70 Rabbit mAb (A11223)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Ku70 Rabbit mAb (A11223) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Ku70 Rabbit mAb (A11223) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ku70 Rabbit mAb (A11223) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Ku70 Rabbit mAb (A11223)

Confocal imaging of U-2 OS cells using Ku70 Rabbit mAb (A11223, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Review

Overview

Product name	Ku70 Rabbit mAb
Catalog No.	A11223
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0551

Background

The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70 (P12956).
Sequence	PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
Gene ID
Swiss Prot
Synonyms	ML8; KU70; TLAA; CTC75; CTCBF; G22P1; Ku70
Calculated MW	70kDa
Observed MW	70kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:6000 - 1:36000 IHC-P 1:200 - 1:800 IF/ICC 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A-549
Cellular location	Chromosome, Nucleus.
Customer validation	(U87-MG 、HepG2 、SHP-77, U2-OS U87-MG SHP-77 HT-29 PC-3) WB(Homo sapiens) IF(Homo sapiens)