Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TEAD1 Rabbit mAb |
---|---|
Catalog No. | A5218 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1157 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TEAD1 (P28347). |
---|---|
Sequence | MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR |
Gene ID | |
Swiss Prot | |
Synonyms | AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1; TEAD1 |
Calculated MW | 48kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | HeLa, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart |
Cellular location | Nucleus. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5218? Please let us know so that we can cite the reference in this datasheet.