제품 > 항체 > 단일클론항체(mAb)

TEAD1 Rabbit mAb (A5218)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ Hep G2 cells with 1 μg TEAD1 Rabbit mAb (A5218), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of TEAD1 in representative gene loci (SLC7A5), as shown in figure.

ABclonal:Western blot - TEAD1 Rabbit mAb (A5218)

Western blot analysis of various lysates using TEAD1 Rabbit mAb (A5218) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - TEAD1 Rabbit mAb (A5218)

Immunoprecipitation analysis of 600 μg extracts of Mouse skeletal muscle cells using 3 μg TEAD1 antibody (A5218). Western blot was performed from the immunoprecipitate using TEAD1 antibody (A5218) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - TEAD1 Rabbit mAb (A5218)

Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using TEAD1 antibody (A5218) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	TEAD1 Rabbit mAb
Catalog No.	A5218
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1157

Background

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TEAD1 (P28347).
Sequence	MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR
Gene ID
Swiss Prot
Synonyms	AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1; TEAD1
Calculated MW	48kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin CUT&Tag 10⁵ cells /1 μg
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart
Cellular location	Nucleus.