제품 > 항체 > 다중클론항체(pAb)

TEAD1 Rabbit pAb (A13366)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TEAD1 Rabbit pAb (A13366) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - TEAD1 Rabbit pAb (A13366)

Immunohistochemistry analysis of paraffin-embedded Rat brain using TEAD1 Rabbit pAb (A13366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using TEAD1 Rabbit pAb (A13366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver using TEAD1 Rabbit pAb (A13366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - TEAD1 Rabbit pAb (A13366)

Immunofluorescence analysis of MCF7 cells using TEAD1 Rabbit pAb (A13366).

ABclonal:Chromatin Immunoprecipitation - TEAD1 Rabbit pAb (A13366)

Chromatin immunoprecipitation analysis of extracts of HeLa cell line, using TEAD1 rabbit polyclonal antibody (A13366) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	TEAD1 Rabbit pAb
Catalog No.	A13366
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEAD1 (NP_068780.2).
Sequence	APSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
Gene ID
Swiss Prot
Synonyms	AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1; TEAD1
Calculated MW	48kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, HeLa, Mouse skeletal muscle, Mouse heart, Rat heart
Cellular location	Nucleus.
Customer validation	WB(Homo sapiens, Mus musculus) ChIP(Homo sapiens)