제품 > 항체 > 단일클론항체(mAb)

TFAM Rabbit mAb (A23467)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using TFAM Rabbit mAb (A23467) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - TFAM Rabbit mAb (A23467)

Immunohistochemistry analysis of paraffin-embedded Human brain tissue using TFAM Rabbit mAb (A23467) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using TFAM Rabbit mAb (A23467) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - TFAM Rabbit mAb (A23467)

Confocal imaging of U-2 OS cells using TFAM Rabbit mAb (A23467, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Chromatin Immunoprecipitation - TFAM Rabbit mAb (A23467)

Chromatin immunoprecipitation analysis of extracts of K-562 cells, using TFAM antibody (A23467) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	TFAM Rabbit mAb
Catalog No.	A23467
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0770

Background

This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TFAM (NP_003192.1).
Sequence	MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQ
Gene ID
Swiss Prot
Synonyms	TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15; TFAM
Calculated MW	29kDa
Observed MW	25kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, MCF7, K-562,
Cellular location	Mitochondrion, Mitochondrion matrix, mitochondrion nucleoid.