Review (1)Publications (13) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Ku80 Rabbit pAb (A5862) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Ku80 Rabbit pAb (A5862) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using Ku80 Rabbit pAb (A5862) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of A549 cells using Ku80 Rabbit pAb (A5862). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using Ku80 Rabbit pAb (A5862) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U2OS cells using Ku80 Rabbit pAb (A5862) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 μg extracts of 293T cells using 1 μg Ku80 antibody ( A5862). Western blot was performed from the immunoprecipitate using Ku80 antibody ( A5862) at a dilution of 1:1000.
| Product name | Ku80 Rabbit pAb |
|---|---|
| Catalog No. | A5862 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 543-732 of human Ku80 (NP_066964.1). |
|---|---|
| Sequence | KKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI |
| Gene ID | |
| Swiss Prot | |
| Synonyms | KU80; KUB2; Ku86; NFIV; KARP1; KARP-1; Ku80 |
| Calculated MW | 83kDa |
| Observed MW | 86kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | A-549, MCF7 |
| Cellular location | Chromosome, Nucleus, nucleolus. |
| Customer validation | (Human renal epithelial cell line) WB(Homo sapiens, Mus musculus) IF(Mus musculus) IP(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5862? Please let us know so that we can cite the reference in this datasheet.
