제품 > 항체 > 다중클론항체(pAb)

L1R Rabbit pAb (A25603)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Monkeypox virus Zaire-96-I-16

Western blot analysis of Recombinant Monkeypox virus L1R Protein (RP01544) using L1R Rabbit pAb (A25603) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 10ng/5ng/1ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	L1R Rabbit pAb
Catalog No.	A25603
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

At present, the study of monkeypox L1 R protein has not been reported. However, studies have shown that vaccinia virus J1R is a membrane protein required for virus growth and plaque formation, and plays a role in the formation of immature virus particles.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of Monkeypox virus Zaire-96-I-16 L1R (NP_536512.1).
Sequence	MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQ
Gene ID
Swiss Prot
Synonyms
Calculated MW	18kDa
Observed MW	17kDa

Applications

Reactivity	Monkeypox virus Zaire-96-I-16
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Recombinant Monkeypox virus L1R Protein
Cellular location	.