제품 > 항체 > 단일클론항체(mAb)

L3MBTL3 Rabbit mAb (A21932)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from 293F cells, using L3MBTL3 Rabbit mAb (A21932) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunoprecipitation - L3MBTL3 Rabbit mAb (A21932)

Immunoprecipitation analysis of 300 μg extracts from 293F cells 3 μg L3MBTL3 Rabbit mAb (A21932 1:100).
Western blot was performed from the immunoprecipitate using L3MBTL3 Rabbit mAb (A21932) at a dilution of 1:2000.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:5000 dilution.

Overview

Product name	L3MBTL3 Rabbit mAb
Catalog No.	A21932
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54019

Background

This gene encodes a member of the malignant brain tumor (MBT) family of chromatin interacting transcriptional repressors. Members of this family function as methyl-lysine readers, which recognize methylated lysine residues on histone protein tails, and are associated with the repression of gene expression. The encoded protein may regulate hematopoiesis. Homozygous deletion of this gene has been observed in human patients with medulloblastoma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human L3MBTL3 (NP_115814.1).
Sequence	MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATATTTWMVPTAQEAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLKADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPPKGKKAWCWASYLEEEKAVAVPAKLFKEHQ
Gene ID
Swiss Prot
Synonyms	MBT1; MBT-1; L3MBTL3
Calculated MW	88kDa
Observed MW	100kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	293F
Cellular location	Nucleus