제품 > 항체 > 다중클론항체(pAb)

LDB1 Rabbit pAb (A17580)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using LDB1 Rabbit pAb (A17580) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - LDB1 Rabbit pAb (A17580)

Immunohistochemistry analysis of paraffin-embedded human uterine cancer using LDB1 Rabbit pAb (A17580) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using LDB1 Rabbit pAb (A17580) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon using LDB1 Rabbit pAb (A17580) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	LDB1 Rabbit pAb
Catalog No.	A17580
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables LIM domain binding activity; RNA polymerase II-specific DNA-binding transcription factor binding activity; and enzyme binding activity. Involved in negative regulation of transcription, DNA-templated and positive regulation of transcription by RNA polymerase II. Located in chromatin. Part of beta-catenin-TCF complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human LDB1 (NP_003884.1).
Sequence	MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECD
Gene ID
Swiss Prot
Synonyms	NLI; CLIM2; LDB-1; CLIM-2; LDB1
Calculated MW	47kDa
Observed MW	46kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brain, Rat brain
Cellular location	nucleoplasm, nucleus