Review (1)Publications (8) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using LDHB Rabbit pAb (A7625) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of LDHB in paraffin-embedded Rat heart tissue using LDHB Rabbit pAb (A7625) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of LDHB in paraffin-embedded Mouse heart tissue using LDHB Rabbit pAb (A7625) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of LDHB in paraffin-embedded Human colon tissue using LDHB Rabbit pAb (A7625) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunofluorescence analysis of Rat heart tissue using LDHB Rabbit pAb (A7625) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.
| Product name | LDHB Rabbit pAb |
|---|---|
| Catalog No. | A7625 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human LDHB (NP_002291.1). |
|---|---|
| Sequence | MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281; LDHB |
| Calculated MW | 37kDa |
| Observed MW | 37kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, A-431, Jurkat, A-549, Mouse brain, Mouse kidney, Mouse heart, Mouse lung, Rat brain |
| Cellular location | Cytoplasm |
| Customer validation | (unknow) WB(Sus scrofa, Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A7625? Please let us know so that we can cite the reference in this datasheet.
![[KO Validated] LDHB Rabbit pAb](https://img.abclonal.com/abclonal-manage/Catalog/A18096/A18096_1.jpg?t=1722783707)
