제품 > 항체 > 다중클론항체(pAb)

LETM2 Rabbit pAb (A13869)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using LETM2 Rabbit pAb (A13869) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	LETM2 Rabbit pAb
Catalog No.	A13869
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable ribosome binding activity. Predicted to be involved in cellular metal ion homeostasis. Predicted to be located in mitochondrial inner membrane. Predicted to be integral component of membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 257-396 of human LETM2 (NP_653253.1).
Sequence	MRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTESKENMVDLAPQLKGTKDEDFIQPPPVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKGA
Gene ID
Swiss Prot
Synonyms	SLC55A2; LETM2
Calculated MW	56kDa
Observed MW	54kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	NCI-H460, 293T, U-87MG, Mouse brain, Mouse testis, Mouse lung, Rat brain, Rat testis, Rat lung
Cellular location	Mitochondrion inner membrane, Single-pass membrane protein