제품 > 항체 > 단일클론항체(mAb)

LH(CGA/LHB) Rabbit mAb (A23921)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from BEWO cells, using LH（CGA/LHB）Rabbit mAb (A23921) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): THP-1
Exposure time: 1s.

ABclonal:Immunohistochemistry - LH(CGA/LHB) Rabbit mAb (A23921)

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using LH(CGA/LHB) Rabbit mAb (A23921) at a dilution of 1:16000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pituitary gland tissue using LH(CGA/LHB) Rabbit mAb (A23921) at a dilution of 1:16000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Overview

Product name	LH(CGA/LHB) Rabbit mAb
Catalog No.	A23921
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62336

Background

The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence corresponding to amino acids 25-116 of human CGA(NP_000726.1) and amino acids 21-141 of human LHB(NP_000885.1) .
Sequence	APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Gene ID
Swiss Prot
Synonyms	HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA; LH(CGA/LHB)
Calculated MW	13KDa/15KDa
Observed MW	18kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:10000 - 1:50000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	BeWo
Cellular location	Secreted, Extracellular.