Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | LILRB3 Rabbit pAb |
---|---|
Catalog No. | A16103 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human LILRB3 (NP_001307889.1). |
---|---|
Sequence | RSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPGGPEDQPLNPPGSGPQNGLGRYLEVLIGVSVAFVLLLFLLLFLLLLRQRHSKHRTSDQRKTDFQ |
Gene ID | |
Swiss Prot | |
Synonyms | HL9; ILT5; LIR3; PIRB; CD85A; ILT-5; LIR-3; PIR-B; LILRA6; LILRB3 |
Calculated MW | 69kDa |
Observed MW | 69kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat |
Cellular location | Cell membrane, Single-pass type I membrane protein |
Customer validation | WB(Mus musculus,Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16103? Please let us know so that we can cite the reference in this datasheet.