제품 > 항체 > 다중클론항체(pAb)

LIN7A Rabbit pAb (A15346)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using LIN7A Rabbit pAb (A15346) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	LIN7A Rabbit pAb
Catalog No.	A15346
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is involved in generating and maintaining the asymmetric distribution of channels and receptors at the cell membrane. The encoded protein also is required for the localization of some specific channels and can be part of a protein complex that couples synaptic vesicle exocytosis to cell adhesion in the brain.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human LIN7A (NP_004655.1).
Sequence	MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATA
Gene ID
Swiss Prot
Synonyms	LIN7; MALS1; VELI1; LIN-7A; MALS-1; TIP-33; LIN7A
Calculated MW	26kDa
Observed MW	23-30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, MCF7, Mouse kidney, Mouse eye, Mouse brain, Rat brain
Cellular location	Basolateral cell membrane, Cell junction, Cell membrane, Peripheral membrane protein, postsynaptic cell membrane, postsynaptic density, synapse, synaptosome, tight junction