제품 > 항체 > 다중클론항체(pAb)

LINS1 Rabbit pAb (A14903)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using LINS1 Rabbit pAb (A14903) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	LINS1 Rabbit pAb
Catalog No.	A14903
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in cognition. Human ortholog(s) of this gene implicated in autosomal recessive non-syndromic intellectual disability. Orthologous to human LINS1 (lines homolog 1).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse LINS1 (NP_690028.2).
Sequence	MRYILDIKMEIVQEILDQLYRKVLLGTTLEDDVHGYIFYLNPDLSEQDGCPAFPVAQSNASGVLDGMAGQHGPSSHEVATLPGAQECPKRQLQMDRTREM
Gene ID
Swiss Prot
Synonyms	Lins; Lins2; Wins2; 2700083B01Rik; LINS1
Calculated MW	55kDa/85kDa
Observed MW	86kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat spleen, Mouse testis, Mouse spleen, Rat testis
Cellular location