제품 > 항체 > 다중클론항체(pAb)

LPAR2 Rabbit pAb (A14819)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HL-60 cells, using LPAR2 Rabbit pAb (A14819) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	LPAR2 Rabbit pAb
Catalog No.	A14819
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of family I of the G protein-coupled receptors, as well as the EDG family of proteins. This protein functions as a lysophosphatidic acid (LPA) receptor and contributes to Ca2+ mobilization, a critical cellular response to LPA in cells, through association with Gi and Gq proteins. An alternative splice variant has been described but its full length sequence has not been determined.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LPAR2 (NP_004711.2).
Sequence	FVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDST
Gene ID
Swiss Prot
Synonyms	EDG4; LPA2; EDG-4; LPA-2; LPAR2
Calculated MW	39kDa
Observed MW	38kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HL-60
Cellular location	Cell membrane, Cell surface, Multi-pass membrane protein