제품 > 항체 > 다중클론항체(pAb)

LPCAT1 Rabbit pAb (A4987)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using LPCAT1 antibody (A4987) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - LPCAT1 Rabbit pAb (A4987)

Immunofluorescence analysis of MCF7 cells using LPCAT1 Rabbit pAb (A4987) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	LPCAT1 Rabbit pAb
Catalog No.	A4987
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor (PAF). Elevated expression of this gene may contribute to the progression of oral squamous cell, prostate, breast, and other human cancers.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 325-534 of human LPCAT1 (NP_079106.3).
Sequence	LPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
Gene ID
Swiss Prot
Synonyms	AYTL2; lpcat; AGPAT9; LPLAT8; PFAAP3; AGPAT10; LPCAT-1; lysoPAFAT
Calculated MW	59kDa
Observed MW	59kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, PC-3, A-549
Cellular location	Endoplasmic reticulum membrane, Golgi apparatus membrane, Lipid droplet, Single-pass type II membrane protein
Customer validation	WB(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens)