Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PPP1CA Rabbit mAb |
---|---|
Catalog No. | A24288 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC61729 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 230-330 of human PPP1CA(NP_002699.1). |
---|---|
Sequence | EVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK |
Gene ID | |
Swiss Prot | |
Synonyms | PP1A; PP-1A; PPP1A; PP1alpha; PPP1CA |
Calculated MW | 38kDa |
Observed MW | 38kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Jurkat, MCF7, NIH/3T3, C6 |
Cellular location | Cytoplasm, Nucleus, nucleolus, nucleoplasm. |
Customer validation | IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24288? Please let us know so that we can cite the reference in this datasheet.