제품 > 항체 > 다중클론항체(pAb)

LRP4 Rabbit pAb (A25225)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunofluorescence analysis of paraffin-embedded Human skeletal muscle tissue using LRP4 Rabbit pAb(A25225) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	LRP4 Rabbit pAb
Catalog No.	A25225
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the low-density lipoprotein receptor-related protein family. The encoded protein may be a regulator of Wnt signaling. Mutations in this gene are associated with Cenani-Lenz syndrome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1621-1720 of human LRP4 (NP_002325.2).
Sequence	NGGCTHLCFARASDFVCACPDEPDSRPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAPGE
Gene ID
Swiss Prot
Synonyms	CLSS; CMS17; LRP-4; LRP10; MEGF7; SOST2; LRP4
Calculated MW	212kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein