제품 > 항체 > 다중클론항체(pAb)

LSM2 Rabbit pAb (A7988)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of various cell lines, using LSM2 antibody (A7988) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	LSM2 Rabbit pAb
Catalog No.	A7988
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 19.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human LSM2 (NP_067000.1).
Sequence	MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Gene ID
Swiss Prot
Synonyms	G7B; snRNP; C6orf28; YBL026W
Calculated MW	11kDa
Observed MW	13kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SW620, SKOV3
Cellular location	Nucleus