Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using Mouse Lipocalin-2/NGAL Rabbit pAb (A24538) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of lysates from Rat uterus, using Mouse Lipocalin-2/NGAL Rabbit pAb (A24538) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Lipocalin-2/NGAL Rabbit pAb (A24538) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Lipocalin-2/NGAL Rabbit pAb (A24538) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of Mouse spleen tissue using Lipocalin-2/NGAL Rabbit pAb (A24538) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.
Immunofluorescence analysis of Human spleen tissue using Lipocalin-2/NGAL Rabbit pAb (A24538) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.
| Product name | Lipocalin-2/NGAL Rabbit pAb |
|---|---|
| Catalog No. | A24538 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant funsion protein containing a sequence corresponding to amino acids 21-200 of mouse Lipocalin-2/NGAL (NP_032517.1). |
|---|---|
| Sequence | QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | 24p3; AW212229; NRL; Sip24; Lipocalin-2/NGAL |
| Calculated MW | 23kDa |
| Observed MW | 23kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse uterus, Mouse spleen, Mouse ovary, Rat uterus |
| Cellular location | Secreted, Cytoplasmic granule lumen, Cytoplasmic vesicle lumen. |
| Customer validation | WB(Mus musculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24538? Please let us know so that we can cite the reference in this datasheet.
