제품 > 항체 > 다중클론항체(pAb)

Ly-6G Rabbit pAb (A20861)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of Mouse bone marrow, using Ly-6G Rabbit pAb (A20861) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - Ly-6G Rabbit pAb (A20861)

Immunofluorescence analysis of mouse spleen cells using Ly-6G Rabbit pAb (A20861) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Ly-6G Rabbit pAb
Catalog No.	A20861
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Located in external side of plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-105 of mouse Ly-6G (NP_001297367.1).
Sequence	LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCN
Gene ID
Swiss Prot
Synonyms	Gr1; Gr-1; Ly-6G
Calculated MW	14kDa
Observed MW	20-40kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse bone marrow
Cellular location	external side of plasma membrane
Customer validation	IF(Mus musculus, Anatinae) WB(Mus musculus) IHC(Anatinae,Mus musculus)