Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MAPRE1 Rabbit pAb |
---|---|
Catalog No. | A2614 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 134-268 of human MAPRE1 (NP_036457.1). |
---|---|
Sequence | ETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY |
Gene ID | |
Swiss Prot | |
Synonyms | EB1; MAPRE1 |
Calculated MW | 30kDa |
Observed MW | 34kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | B-cell, U-87MG, LO2, HT-29, NIH/3T3, Mouse lung, Mouse spleen, Rat heart |
Cellular location | Cytoplasm, centrosome, cytoskeleton, microtubule organizing center. |
Customer validation | WB(Tianfu broilers ) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2614? Please let us know so that we can cite the reference in this datasheet.