Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | MAS1L Rabbit pAb |
---|---|
Catalog No. | A16162 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP_443199.1). |
---|---|
Sequence | MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ |
Gene ID | |
Swiss Prot | |
Synonyms | MRG; MAS-L; dJ994E9.2; MAS1L |
Calculated MW | 42kDa |
Observed MW | 42kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver, Rat liver |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB(Homo sapiens, Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16162? Please let us know so that we can cite the reference in this datasheet.