제품 > 항체 > 단일클론항체(mAb)

MAVS Rabbit mAb (A25005)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Hep G2 cells using MAVS Rabbit mAb (A25005) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunofluorescence - MAVS Rabbit mAb (A25005)

Confocal imaging of NIH/3T3 cells using MAVS Rabbit mAb (A25005, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunohistochemistry - MAVS Rabbit mAb (A25005)

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using MAVS Rabbit mAb (A25005) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using MAVS Rabbit mAb (A25005) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using MAVS Rabbit mAb (A25005) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using MAVS Rabbit mAb (A25005) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	MAVS Rabbit mAb
Catalog No.	A25005
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61547

Background

This gene encodes an intermediary protein necessary in the virus-triggered beta interferon signaling pathways. It is required for activation of transcription factors which regulate expression of beta interferon and contributes to antiviral innate immunity.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 121-220 of human MAVS mAb (NP_065797.2).
Sequence	TPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGP
Gene ID
Swiss Prot
Synonyms	IPS1; VISA; IPS-1; CARDIF; MAVS
Calculated MW	57kDa
Observed MW	55kDa, 70kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500-1:1000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Hep G2
Cellular location	Mitochondrion, mitochondrion outer membrane, peroxisome.
Customer validation	Other(Danio rerio)