제품 > 항체 > 다중클론항체(pAb)

MAdCAM-1 Rabbit pAb (A24489)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of Mouse small intestine, using MAdCAM-1 Rabbit pAb (A24489) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	MAdCAM-1 Rabbit pAb
Catalog No.	A24489
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable integrin binding activity involved in cell-matrix adhesion. Acts upstream of or within keratinocyte differentiation and leukocyte migration. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in eyelid; hair follicle; and hemolymphoid system. Orthologous to human MADCAM1 (mucosal vascular addressin cell adhesion molecule 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-109 of mouse MAdCAM-1 (NP_038619.2).
Sequence	QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARVHWRGLDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRSFQHSVKILVY
Gene ID
Swiss Prot
Synonyms	MAdCAM-1
Calculated MW	43kDa
Observed MW	60kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse small intestine
Cellular location