제품 > 항체 > 단일클론항체(mAb)

MCM7 Rabbit mAb (A11325)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using MCM7 Rabbit mAb (A11325) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - MCM7 Rabbit mAb (A11325)

Confocal imaging of HeLa cells using MCM7 Rabbit mAb (A11325, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - MCM7 Rabbit mAb (A11325)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg MCM7 antibody (A11325). Western blot was performed from the immunoprecipitate using MCM7 antibody (A11325) at a dilution of 1:1000.

Overview

Product name	MCM7 Rabbit mAb
Catalog No.	A11325
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0573

Background

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MCM7 (P33993).
Sequence	YTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE
Gene ID
Swiss Prot
Synonyms	MCM2; CDC47; P85MCM; P1CDC47; PNAS146; PPP1R104; P1.1-MCM3; MCM7
Calculated MW	81kDa
Observed MW	81kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, Hep G2, U-87MG
Cellular location	Nucleus
Customer validation	WB(Homo sapiens) IHC(Homo sapiens)