Reviews (2)Publications (11) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from T-47D cells, using MCT1/SLC16A1 Rabbit pAb (A3013) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of HeLa cells using MCT1/SLC16A1 Rabbit pAb (A3013) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | MCT1/SLC16A1 Rabbit pAb |
|---|---|
| Catalog No. | A3013 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-245 of human MCT1 (NP_003042.3). |
|---|---|
| Sequence | VAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MCT; HHF7; MCT1; MCT1D; MCT1/SLC16A1 |
| Calculated MW | 54kDa |
| Observed MW | 43kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | T-47D |
| Cellular location | Cell membrane, Multi-pass membrane protein. |
| Customer validation | (Pancreatic cancer cells, HCT116) IF(Homo sapiens, Mus musculus, Rattus norvegicus) WB(Mus musculus, Homo sapiens, Mus musculus, Rattus norvegicus) IF(Homo sapiens, Mus musculus) IP(Homo sapiens, Mus musculus) WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A3013? Please let us know so that we can cite the reference in this datasheet.
![[KD Validated] MCT1 Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A27270/A27270_1.jpg?t=1736942836)
