Reviews (2)Publications (34) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | METTL14 Rabbit pAb |
---|---|
Catalog No. | A8530 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human METTL14 (NP_066012.1). |
---|---|
Sequence | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC |
Gene ID | |
Swiss Prot | |
Synonyms | hMETTL14; METTL14 |
Calculated MW | 52kDa |
Observed MW | 65kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse testis, Rat testis |
Cellular location | Nucleus. |
Customer validation | (Human breast cancer) WB(Mus musculus, Rattus norvegicus, Homo sapiens, Sus scrofa, Rattus norvegicus, Mus musculus) Co-IP(Homo sapiens) IF(Homo sapiens, Rattus norvegicus, Mus musculus) Co-IP(Homo sapiens, Mus musculus) IP(Mus musculus) IF(Mus musculus, Rattus norvegicus) IHC(Rattus norvegicus, Homo sapiens) RIP(Homo sapiens) RT-PCR(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A8530? Please let us know so that we can cite the reference in this datasheet.