제품 > 항체 > 다중클론항체(pAb)

METTL7B Rabbit pAb (A7200)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of Rat liver, using METTL7B antibody (A7200) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts of various cell lines, using METTL7B antibody (A7200) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - METTL7B Rabbit pAb (A7200)

Immunofluorescence analysis of HepG2 cells using METTL7B Rabbit pAb (A7200) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-251MG cells using METTL7B Rabbit pAb (A7200) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	METTL7B Rabbit pAb
Catalog No.	A7200
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables thiol S-methyltransferase activity. Predicted to be involved in methylation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 165-244 of human METTL7B (NP_689850.2).
Sequence	RPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK
Gene ID
Swiss Prot
Synonyms	ALDI; METTL7B
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HT-29, Mouse liver, Rat liver
Cellular location	lipid droplet
Customer validation	IHC(Homo sapiens) WB(Homo sapiens) IHC(Homo sapiens)