제품 > 항체 > 다중클론항체(pAb)

MIXL1 Rabbit pAb (A17223)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MIXL1 Rabbit pAb (A17223) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

Overview

Product name	MIXL1 Rabbit pAb
Catalog No.	A17223
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables RNA polymerase II-specific DNA-binding transcription factor binding activity and sequence-specific double-stranded DNA binding activity. Predicted to be involved in several processes, including endodermal cell differentiation; hematopoietic progenitor cell differentiation; and positive regulation of mesoderm development. Predicted to act upstream of or within cell migration involved in gastrulation and hemopoiesis. Located in nucleoplasm.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-232 of human MIXL1 (NP_114150.1).
Sequence	QPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF
Gene ID
Swiss Prot
Synonyms	MIX; MIXL; MILD1; MIXL1
Calculated MW	25kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Raji, 293T, Mouse pancreas, Mouse liver, Rat pancreas
Cellular location	nucleoplasm
Customer validation	IF(Homo sapiens) RT-qPCR(Homo sapiens) Other(Escherichia coli)