Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | MLC1 Rabbit pAb |
---|---|
Catalog No. | A12840 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human MLC1 (NP_055981.1). |
---|---|
Sequence | SYDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLKEFDKEKAWRAVVVQMAQ |
Gene ID | |
Swiss Prot | |
Synonyms | VL; LVM; MLC; MLC1 |
Calculated MW | 41kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SH-SY5Y |
Cellular location | Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Multi-pass membrane protein, perinuclear region |
Customer validation | WB(Rattus norvegicus, Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12840? Please let us know so that we can cite the reference in this datasheet.