제품 > 항체 > 다중클론항체(pAb)

MLC1 Rabbit pAb (A12840)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from SH-SY5Y cells, using MLC1 Rabbit pAb (A12840) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	MLC1 Rabbit pAb
Catalog No.	A12840
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The function of this gene product is unknown; however, homology to other proteins suggests that it may be an integral membrane transporter. Mutations in this gene have been associated with megalencephalic leukoencephalopathy with subcortical cysts, an autosomal recessive neurological disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human MLC1 (NP_055981.1).
Sequence	SYDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLKEFDKEKAWRAVVVQMAQ
Gene ID
Swiss Prot
Synonyms	VL; LVM; MLC; MLC1
Calculated MW	41kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SH-SY5Y
Cellular location	Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Multi-pass membrane protein, perinuclear region
Customer validation	WB(Rattus norvegicus, Homo sapiens)