Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | MLKL Rabbit mAb |
---|---|
Catalog No. | A26436 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC70166 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 369-471 of human MLKL (NP_689862.1). |
---|---|
Sequence | DRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK |
Gene ID | |
Swiss Prot | |
Synonyms | hMLKL |
Calculated MW | 54kDa |
Observed MW | 56kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | NIH/3T3, HeLa, HUVEC |
Cellular location | cell junction, cytoplasm, cytosol, nucleus, plasma membrane, Cell membrane, Cytoplasm, Nucleus. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A26436? Please let us know so that we can cite the reference in this datasheet.