Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MMP1 Rabbit mAb |
---|---|
Catalog No. | A22080 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55239 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 93-210 of human MMP1 (NP_002412.1). |
---|---|
Sequence | GVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY |
Gene ID | |
Swiss Prot | |
Synonyms | CLG; CLGN; MMP1 |
Calculated MW | 54kDa |
Observed MW | 62kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-375, SK-OV-3, Mouse bone, Rat spleen |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Danio rerio, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22080? Please let us know so that we can cite the reference in this datasheet.