제품 > 항체 > 다중클론항체(pAb)

MOB1A/MOB1B Rabbit pAb (A18246)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using MOB1A/MOB1B Rabbit pAb (A18246) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of various lysates, using MOB1A/MOB2B Rabbit pAb (A18246) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - MOB1A/MOB1B Rabbit pAb (A18246)

Immunofluorescence analysis of L929 cells using MOB1A/MOB1B Rabbit pAb (A18246) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	MOB1A/MOB1B Rabbit pAb
Catalog No.	A18246
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein MOB1 is considered to be one of the core components of the mammalian Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. MOB1A and MOB1B, which have 95% sequence identity, play redundant biological roles and are both termed MOB1.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB1A/MOB1B (NP_060691.2/NP_775739.1).
Sequence	TILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR/MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAE
Gene ID
Swiss Prot
Synonyms	MOB1A/MOB1B
Calculated MW
Observed MW	24kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	K-562, Daudi, NIH/3T3, C6, C2C12
Cellular location	cytoplasm, cytosol, extracellular exosome, nucleolus, nucleoplasm, nucleus.