제품 > 항체 > 다중클론항체(pAb)

MOB1A/MOB1B Rabbit pAb (A18246)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat

ABclonal:Western blot - MOB1A/MOB1B Rabbit pAb (A18246)

Western blot analysis of various lysates, using MOB1A/MOB1B Rabbit pAb (A18246) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - MOB1A/MOB1B Rabbit pAb (A18246)

Western blot analysis of various lysates, using MOB1A/MOB2B Rabbit pAb (A18246) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - MOB1A/MOB1B Rabbit pAb (A18246)

Immunofluorescence analysis of L929 cells using MOB1A/MOB1B Rabbit pAb (A18246) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product nameMOB1A/MOB1B Rabbit pAb
Catalog No.A18246
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
The protein MOB1 is considered to be one of the core components of the mammalian Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. MOB1A and MOB1B, which have 95% sequence identity, play redundant biological roles and are both termed MOB1.
ImmunogenA synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB1A/MOB1B (NP_060691.2/NP_775739.1).
SequenceTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR/MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAE
Gene ID
Swiss Prot
SynonymsMOB1A/MOB1B
Calculated MW
Observed MW24kDa
ReactivityHuman, Mouse, Rat
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage bufferStore at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key applicationWestern blotting    Immunofluorescence    
Positive samplesK-562, Daudi, NIH/3T3, C6, C2C12
Cellular locationcytoplasm, cytosol, extracellular exosome, nucleolus, nucleoplasm, nucleus.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

    ABclonal:Western blot - MOB1A/MOB1B Rabbit pAb (A18246)}

    Western blot - MOB1A/MOB1B Rabbit pAb (A18246)

    Western blot analysis of various lysates, using MOB1A/MOB1B Rabbit pAb (A18246) at 1:1500 dilution.
    Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
    Lysates/proteins: 25μg per lane.
    Blocking buffer: 3% nonfat dry milk in TBST.
    Detection: ECL Basic Kit (RM00020).
    Exposure time: 10s.
    ABclonal:Western blot - MOB1A/MOB1B Rabbit pAb (A18246)}

    Western blot - MOB1A/MOB1B Rabbit pAb (A18246)

    Western blot analysis of various lysates, using MOB1A/MOB2B Rabbit pAb (A18246) at 1:1500 dilution.
    Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
    Lysates/proteins: 25μg per lane.
    Blocking buffer: 3% nonfat dry milk in TBST.
    Detection: ECL Basic Kit (RM00020).
    Exposure time: 30s.
    ABclonal:Immunofluorescence - MOB1A/MOB1B Rabbit pAb (A18246)}

    Immunofluorescence - MOB1A/MOB1B Rabbit pAb (A18246)

    Immunofluorescence analysis of L929 cells using MOB1A/MOB1B Rabbit pAb (A18246) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

    * For research use only. Not for therapeutic or diagnostic purposes.

    항체 (1)

    Secondary Antibodies (25)