제품 > 항체 > 다중클론항체(pAb)

MPC1 Rabbit pAb (A20195)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MPC1 Rabbit pAb (A20195) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - MPC1 Rabbit pAb (A20195)

Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg MPC1 antibody (A20195). Western blot was performed from the immunoprecipitate using MPC1 antibody (A20195) at a dilution of 1:1000.

Overview

Product name	MPC1 Rabbit pAb
Catalog No.	A20195
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-109 of human MPC1 (NP_057182.1).
Sequence	IISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
Gene ID
Swiss Prot
Synonyms	MPYCD; BRP44L; CGI-129; SLC54A1; MPC1
Calculated MW	12kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HepG2, K-562, Mouse liver, Rat heart
Cellular location	inner mitochondrial membrane protein complex, mitochondrial inner membrane, mitochondrion
Customer validation	IF(Rattus norvegicus) WB(Rattus norvegicus)