Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | MPST Rabbit pAb |
---|---|
Catalog No. | A11587 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-170 of human MPST (NP_066949.2). |
---|---|
Sequence | LVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPA |
Gene ID | |
Swiss Prot | |
Synonyms | MST; TST2; TUM1; MPST |
Calculated MW | 33kDa |
Observed MW | 35kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver, Rat liver |
Cellular location | Cell junction, Cytoplasm, Mitochondrion, synapse, synaptosome |
Customer validation | WB(Mus musculus, Rattus norvegicus, Other) IHC(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11587? Please let us know so that we can cite the reference in this datasheet.