제품 > 항체 > 다중클론항체(pAb)

MPZL1 Rabbit pAb (A13059)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MPZL1 Rabbit pAb (A13059) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	MPZL1 Rabbit pAb
Catalog No.	A13059
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable structural molecule activity. Predicted to be involved in cell-cell signaling and transmembrane receptor protein tyrosine kinase signaling pathway. Predicted to act upstream of or within positive regulation of cell migration. Located in cell surface and focal adhesion.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 195-269 of human MPZL1 (NP_003944.1).
Sequence	NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Gene ID
Swiss Prot
Synonyms	PZR; PZRa; PZRb; PZR1b; MPZL1b; MPZL1
Calculated MW	29kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	BxPC-3, HeLa, Mouse brain
Cellular location	Membrane, Single-pass type I membrane protein