제품 > 항체 > 다중클론항체(pAb)

MSRB1 Rabbit pAb (A6737)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MSRB1 Rabbit pAb (A6737) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - MSRB1 Rabbit pAb (A6737)

Immunohistochemistry analysis of MSRB1 in paraffin-embedded Human colon tissue using MSRB1 Rabbit pAb (A6737) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of MSRB1 in paraffin-embedded Rat testis tissue using MSRB1 Rabbit pAb (A6737) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of MSRB1 in paraffin-embedded Mouse testis tissue using MSRB1 Rabbit pAb (A6737) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - MSRB1 Rabbit pAb (A6737)

Immunofluorescence analysis of HeLa cells using MSRB1 Rabbit pAb (A6737). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	MSRB1 Rabbit pAb
Catalog No.	A6737
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methionines. This protein is highly expressed in liver and kidney, and is localized to the nucleus and cytosol. It is the only member of the MsrB family that is a selenoprotein, containing a selenocysteine (Sec) residue at its active site. It also has the highest methionine-R-sulfoxide reductase activity compared to other members containing cysteine in place of Sec. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A pseudogene of this locus has been identified on chromosome 19.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human MSRB1 (NP_057416.1).
Sequence	MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRF
Gene ID
Swiss Prot
Synonyms	SELR; SELX; SepR; SEPX1; HSPC270; SELENOR; SELENOX; MSRB1
Calculated MW	13kDa
Observed MW	13kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HL-60, SW620, Mouse brain, Mouse kidney, Rat brain
Cellular location	Cytoplasm, Nucleus, cytoskeleton
Customer validation	WB(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구내분비 & 대사아미노산 대사

MSRB1 Rabbit pAb images

Western blot - MSRB1 Rabbit pAb (A6737)

Immunohistochemistry - MSRB1 Rabbit pAb (A6737)

Immunofluorescence - MSRB1 Rabbit pAb (A6737)

Immunofluorescence analysis of HeLa cells using MSRB1 Rabbit pAb (A6737). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.