제품 > 항체 > 다중클론항체(pAb)

MTDH Rabbit pAb (A5887)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from PC-12 cells, using MTDH Rabbit pAb (A5887) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 7s.

ABclonal:Immunohistochemistry - MTDH Rabbit pAb (A5887)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using MTDH Rabbit pAb (A5887) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using MTDH Rabbit pAb (A5887) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse spinal cord using MTDH Rabbit pAb (A5887) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat brain using MTDH Rabbit pAb (A5887) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - MTDH Rabbit pAb (A5887)

Immunofluorescence analysis of U2OS cells using MTDH Rabbit pAb (A5887) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	MTDH Rabbit pAb
Catalog No.	A5887
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables NF-kappaB binding activity; double-stranded RNA binding activity; and transcription coactivator activity. Involved in several processes, including lipopolysaccharide-mediated signaling pathway; positive regulation of intracellular signal transduction; and regulation of transcription, DNA-templated. Located in endoplasmic reticulum; nuclear lumen; and perinuclear region of cytoplasm. Implicated in hepatocellular carcinoma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human MTDH (NP_848927.2).
Sequence	MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYGWAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEAVRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNF
Gene ID
Swiss Prot
Synonyms	3D3; AEG1; AEG-1; LYRIC; LYRIC/3D3; MTDH
Calculated MW	64kDa
Observed MW	75kDa/80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	PC-12
Cellular location	Cell junction, Cytoplasm, Endoplasmic reticulum membrane, Nucleus, Nucleus membrane, Single-pass membrane protein, nucleolus, perinuclear region, tight junction
Customer validation	WB(Homo sapiens, Mus musculus)