Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates using MT-ND1 Rabbit pAb (A5250) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
| Product name | MT-ND1 Rabbit pAb |
|---|---|
| Catalog No. | A5250 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse MT-ND1 (NP_904328.1). |
|---|---|
| Sequence | MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | TrnI; MT-ND1 |
| Calculated MW | 36kDa |
| Observed MW | 36kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | 293T, HeLa |
| Cellular location | Mitochondrion inner membrane, Multi-pass membrane protein |
| Customer validation | WB(Homo sapiens, Mus musculus) Co-IP(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5250? Please let us know so that we can cite the reference in this datasheet.
