Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Mouse eye, using MTNR1A Rabbit pAb (A13030) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Rat brain using MTNR1A Rabbit pAb (A13030) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Product name | MTNR1A Rabbit pAb |
|---|---|
| Catalog No. | A13030 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 281-350 of human MTNR1A (NP_005949.1). |
|---|---|
| Sequence | YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MT1; MEL-1A-R; MTNR1A |
| Calculated MW | 39kDa |
| Observed MW | 39kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | Mouse eye |
| Cellular location | Cell membrane, Multi-pass membrane protein |
| Customer validation | IF(Rattus norvegicus, Mus musculus) WB(Rattus norvegicus, Mus musculus, Homo sapiens, Mus musculus) IHC(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A13030? Please let us know so that we can cite the reference in this datasheet.
