제품 > 항체 > 다중클론항체(pAb)

MTSS1 Rabbit pAb (A11697)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MTSS1 Rabbit pAb (A11697) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	MTSS1 Rabbit pAb
Catalog No.	A11697
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables actin monomer binding activity; identical protein binding activity; and signaling receptor binding activity. Predicted to be involved in cellular response to fluid shear stress; negative regulation of epithelial cell proliferation; and urogenital system development. Predicted to act upstream of or within several processes, including actin filament polymerization; adherens junction maintenance; and magnesium ion homeostasis. Located in actin cytoskeleton.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 630-730 of human MTSS1 (NP_055566.3).
Sequence	LPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGED
Gene ID
Swiss Prot
Synonyms	MIM; MIMA; MIMB; MTSS1
Calculated MW	82kDa
Observed MW	115kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, HT-29, U-87MG, Mouse liver, Mouse brain, Mouse heart, Rat liver
Cellular location	Cytoplasm, cytoskeleton
Customer validation	WB(Homo sapiens)