제품 > 항체 > 다중클론항체(pAb)

MX1 Rabbit pAb (A1780)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Daudi cells, using MX1 Rabbit pAb (A1780) at 1:600 dilution.Daudi cells were treated by IFN-α (100 ng/ml) at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - MX1 Rabbit pAb (A1780)

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using MX1 Rabbit pAb (A1780) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - MX1 Rabbit pAb (A1780)

Immunofluorescence analysis of A431 cells using MX1 Rabbit pAb (A1780) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of A-549 cells using MX1 Rabbit pAb (A1780) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	MX1 Rabbit pAb
Catalog No.	A1780
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA and DNA viruses. There is a related gene located adjacent to this gene on chromosome 21, and there are multiple pseudogenes located in a cluster on chromosome 4. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human MX1 (NP_001171517.1).
Sequence	TLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
Gene ID
Swiss Prot
Synonyms	MX; MxA; IFI78; IFI-78K; lncMX1-215; MX1
Calculated MW	76kDa
Observed MW	76kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Daudi treated by IFN-α
Cellular location	Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Nucleus, Peripheral membrane protein, perinuclear region
Customer validation	WB(Homo sapiens)